ELISA Recombinant Pomoxis nigromaculatus Cytochrome b(mt-cyb)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pomoxis nigromacµLatus (Black crappie)
Uniprot NO.:P29670
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LTGLFLAMHYTSDIATAFSSVAHICRDVNYGWLIRNIHANGASFFFICIYLHIGRGLYYG SYLYKETWNVGVVLLLLVMMTAFVG
Protein Names:Recommended name: Cytochrome b Alternative name(s): Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunit
Gene Names:Name:mt-cyb Synonyms:cob, cytb, mtcyb
Expression Region:1-85
Sequence Info:fµLl length protein
Our Product
Check out what's in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.