ELISA Recombinant Cryptelytrops albolabris NADH-ubiquinone oxidoreductase chain 4(MT-ND4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Cryptelytrops albolabris (White-lipped pit viper) (Trimeresurus albolabris) Uniprot NO.:O03780 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:PIAGSMVLAAILLKLGGYGIIRMMQIMPTTKTDTFLPFLVLALWGAILANLTCLQQTDLK SLIAYSSISHMGLVVAAIIIQTPWGLSGAMALMIAHGFTSSALFCLANTTYERTHTRILI LTRGFHNILPMATTWWLLTNLMNIATPPTMNFTSELLIMSTLFNWCPTTIILLGLSmLIT ASYSLHMFLSTQTGYPLLNNQTEPTHTREHLLMILHIVPLMMISMKPELVI Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4 Gene Names:Name:MT-ND4 Synonyms:MTND4, NADH4, ND4 Expression Region:1-231 Sequence Info:fµLl length protein