Skip to Content

ELISA Recombinant Natural cytotoxicity triggering receptor 1(NCR1)

https://www.colorectalresearch.com/web/image/product.template/135754/image_1920?unique=45d657d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O76036 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL Protein Names:Recommended name: Natural cytotoxicity triggering receptor 1 Alternative name(s): Lymphocyte antigen 94 homolog NK cell-activating receptor Natural killer cell p46-related protein Short name= NK-p46 Short name= NKp46 Short name= hNKp46 CD_antigen= CD335 Gene Names:Name:NCR1 Synonyms:LY94 Expression Region:22-304 Sequence Info:fµLl length protein

1,634.00 € 1634.0 EUR 1,634.00 €

1,634.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product 

Check out what's in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.