ELISA Recombinant Meriones unguiculatus Monocarboxylate transporter 2(SLC16A7)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Meriones unguicµLatus (Mongolian jird) (Mongolian gerbil)
Uniprot NO.:O35440
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AFVDMFSRPCGGLIANTRLVRPRIQYFFSLAIVFTGVCHLLCPLAESYTALVVYAIFFGY GFGSVSSILFE
Protein Names:Recommended name: Monocarboxylate transporter 2 Short name= MCT 2 Alternative name(s): Solute carrier family 16 member 7
Gene Names:Name:SLC16A7 Synonyms:MCT2
Expression Region:1-71
Sequence Info:fµLl length protein
Our Product
Check out what's in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.