Skip to Content

ELISA Recombinant Meriones unguiculatus Monocarboxylate transporter 2(SLC16A7)

https://www.colorectalresearch.com/web/image/product.template/142866/image_1920?unique=62ab6da
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Meriones unguicµLatus (Mongolian jird) (Mongolian gerbil) Uniprot NO.:O35440 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AFVDMFSRPCGGLIANTRLVRPRIQYFFSLAIVFTGVCHLLCPLAESYTALVVYAIFFGY GFGSVSSILFE Protein Names:Recommended name: Monocarboxylate transporter 2 Short name= MCT 2 Alternative name(s): Solute carrier family 16 member 7 Gene Names:Name:SLC16A7 Synonyms:MCT2 Expression Region:1-71 Sequence Info:fµLl length protein

1,410.00 € 1410.0 EUR 1,410.00 €

1,410.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product 

Check out what's in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.