ELISA Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0323 (MJ0323)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) Uniprot NO.:P81301 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFLALTSIAIPAAIVIPISLIANLPNCGISLTFSMTIGFVGLILTIAASPVFKNCGFSSM TCPVLGSNFFNNSMNVHATCAVCAWKTGV Protein Names:Recommended name: Uncharacterized protein MJ0323 Gene Names:Ordered Locus Names:MJ0323 Expression Region:1-89 Sequence Info:fµLl length protein