Skip to Content

ELISA Recombinant Typhonium venosum Alternative oxidase, mitochondrial(AOX1)

https://www.colorectalresearch.com/web/image/product.template/160305/image_1920?unique=871b00d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Typhonium venosum (Voodoo lily) (Sauromatum guttatum) Uniprot NO.:P22185 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ASTLSAPAQDGGKEKAAGTAGKVPPGEDGGAEKEAVVSYWAVPPSKVSKEDGSEWRWTCF RPWETYQADLSIDLHKHHVPTTILDKLALRTVKALRWPTDIFFQRRYACRAMmLETVAAV PGMVGGVLLHLKSLRRFEHSGGWIRALLEEAENERMHLMTFMEVAQPRWYERALVLAVQG VFFNAYFLGYLLSPKFAHRVVGYLEEEAIHSYTEFLKDIDSGAIQDCPAPAIALDYWRLP QGSTLRDVVTVVRADEAHHRDVNHFASDVHYQDLELKTTPAPLGYH Protein Names:Recommended name: Alternative oxidase, mitochondrial EC= 1.-.-.- Gene Names:Name:AOX1 Expression Region:64-349 Sequence Info:fµLl length protein

1,637.00 € 1637.0 EUR 1,637.00 €

1,637.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product 

Check out what's in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.