ELISA Recombinant Schizosaccharomyces pombe ATP synthase subunit 9, mitochondrial(atp9)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:P21537 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIQAAKYIGAGLATIGVSGAGVGIGLIFSNLISGTSRNPSVRPHLFSMAILGFALTEATG LFCLmLAFLIIYAA Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein Gene Names:Name:atp9 ORF Names:SPMIT.10 Expression Region:1-74 Sequence Info:fµLl length protein