ELISA Recombinant Thermosynechococcus vulcanus Photosystem I reaction center subunit PsaK(psaK)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Thermosynechococcus vµLcanus (Synechococcus vµLcanus) Uniprot NO.:P23318 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TLPDTTWTPSVGLVVILSNLFAIALGRYAIQSRGKGPGLPIALPALFEGFGLPELLATTS FGHLLAAGVVSVGLQYAGAL Protein Names:Recommended name: Photosystem I reaction center subunit PsaK Alternative name(s): Light-harvesting 6.5 kDa polypeptide Photosystem I subunit X Gene Names:Name:psaK Expression Region:6-85 Sequence Info:fµLl length protein