ELISA Recombinant Haemophilus influenzae Uncharacterized protein HI_0318 (HI_0318)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) Uniprot NO.:P43984 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLFINITFACILAIRFYSLSISIRHEKALIAKGAIQYGKRNSTLLSIAHVAFYFAAIIEA NKQNLSFNSTSQIGLAILIFAIAmLFYVIYELKEIWTVKIYILPEHQINRSFLFKYVRHP NYFLNIIPELIGLSLFCQAKYTALVGLPIYLLILAVRIKQEESAMSHLFPKS Protein Names:Recommended name: Uncharacterized protein HI_0318 Gene Names:Ordered Locus Names:HI_0318 Expression Region:1-172 Sequence Info:fµLl length protein