Skip to Content

ELISA Recombinant Feline enteric coronavirus Non-structural 7a protein (7a)

https://www.colorectalresearch.com/web/image/product.template/127427/image_1920?unique=812c222
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Feline enteric coronavirus (strain 79-1683) (FeCoV) (FECV) Uniprot NO.:P33465 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LERLLLSHLLNLTTVSNVLGVPDSSLRVNCLQLLKPDCLDFNILHKVLAETRLLVVVLRV IFLVLLGFSCYTLLGALF Protein Names:Recommended name: Non-structural 7a protein Short name= ns7a Alternative name(s): 11 kDa protein Accessory protein 7a Gene Names:ORF Names:7a Expression Region:24-101 Sequence Info:fµLl length protein

1,417.00 € 1417.0 EUR 1,417.00 €

1,417.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product 

Check out what's in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.