ELISA Recombinant Feline enteric coronavirus Non-structural 7a protein (7a)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Feline enteric coronavirus (strain 79-1683) (FeCoV) (FECV)
Uniprot NO.:P33465
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LERLLLSHLLNLTTVSNVLGVPDSSLRVNCLQLLKPDCLDFNILHKVLAETRLLVVVLRV IFLVLLGFSCYTLLGALF
Protein Names:Recommended name: Non-structural 7a protein Short name= ns7a Alternative name(s): 11 kDa protein Accessory protein 7a
Gene Names:ORF Names:7a
Expression Region:24-101
Sequence Info:fµLl length protein
Our Product
Check out what's in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.