ELISA Recombinant Uncharacterized protein Rv0476-MT0494.1 (Rv0476, MT0494.1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mycobacterium tubercµLosis Uniprot NO.:P64695 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ALQRPDAYTAADKLTKPVWLVILGAAVALASILYPVLGVLGMAMSACASGVYLVDVRPKL LEIQGKSR Protein Names:Recommended name: Uncharacterized protein Rv0476/MT0494.1 Gene Names:Ordered Locus Names:Rv0476, MT0494.1 ORF Names:MTCY20G9.02 Expression Region:20-87 Sequence Info:fµLl length protein