ELISA Recombinant UPF0410 protein yeaQ(yeaQ)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Escherichia coli O157:H7 Uniprot NO.:P64487 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGILSWIIFGLIAGILAKWIMPGKDGGGFFMTILLGIVGAVVGGWISTLFGFGKVDGFNF GSFVVAVIGAIVVLFIYRKIKS Protein Names:Recommended name: UPF0410 protein yeaQ Gene Names:Name:yeaQ Ordered Locus Names:Z2837, ECs2504 Expression Region:1-82 Sequence Info:fµLl length protein