ELISA Recombinant Pyrenophora tritici-repentis Probable endonuclease lcl3(lcl3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis) Uniprot NO.:B2WC78 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRWPWSGDDHEQNKSSRLWATSPKSSDWPSTLVEPRTLIATLALTVSTVAGVRLYKTYLR RIPTVNHIKPNYFRRKSLFGQVTSVGDADNFRLYHTPGGRIAGWGLLPWKRIPTKREDLT KQTLHIRIAGVDAPELAHWGREAQPFSKEAHDWLINLIHNRRVRAYIYRRDQYDRVVAQV YVRRWLFRKDVGLEmLRAGLATVYEAKTGAEFGTVEDKYRAAEQKARDSKVGMWAKPTLR QRLGGAPTQPPESPREYKNRHNAAEKLKKPG Protein Names:Recommended name: Probable endonuclease lcl3 EC= 3.1.-.- Gene Names:Name:lcl3 ORF Names:PTRG_07587 Expression Region:1-271 Sequence Info:fµLl length protein