ELISA Recombinant Geobacter bemidjiensis UPF0059 membrane protein Gbem_1700 (Gbem_1700)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622)
Uniprot NO.:B5E9H5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDWLTILGISVALAMDAFAVALAAGAVISPITGRHLFRLGFHFGLFQALMPIGGWLLGMT VQKWISAYDHWIAFGLLAYVGGRMVHEAFEEDDEEKTPSDPTKGMTMVmLSVATSIDAFA VGLSIAmLGVSVWLPATVIGLVAGVLTVAGmLLGRRLGEKWGKRVEICGGLVLCLIGLKI LLEHTLLK
Protein Names:Recommended name: UPF0059 membrane protein Gbem_1700
Gene Names:Ordered Locus Names:Gbem_1700
Expression Region:1-188
Sequence Info:fµLl length protein
Our Product
Check out what's in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.