Skip to Content

ELISA Recombinant Zygosaccharomyces rouxii Nuclear rim protein 1(NUR1)

https://www.colorectalresearch.com/web/image/product.template/162284/image_1920?unique=7c948e0
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) (Candida mogii) Uniprot NO.:C5DQ18 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLRISKDVSVSVNTADLLPEDDGFDRVDGDNRGWFSVFLGLFNTHPSDWNIALNEAIET IDWDSKSITLAQPLGNFFTFAFYVVRLLQLSLIKPNLSRINEKTDHFDLSKSEmLKKYEY LYHFTNDKNQSVGNVYYRFLGRLGKFFDICIVLLTFTNGFITYKFFWGNFKMYCLFYLKK GPHLRNVTKASLQKLGQDDDDGSLWSSLRYFWNGTKDKEGSTDDRDDDDGDIHYKLFKWT PSQFITmLFVSFAPTAVVFLLFTEVSFLTLIAVIVHQWVLHRLVIDCYGNRLVHESVIAS ANLAEVEAKFVKPRMSKKVQDVAIDCTPHGDGMVKFYPALTTNRSHIFQTHSLTGELITE TFNPSTKEFEDLQTEGTTHNVIRTAPYAAGDLLHRDPYWYQRNMIMRDVAHRPYFHSREV SPTRYHPSRISPRPGQYSPLVSSTSGMSTPLMRPDRSPFLNTRPSLGEREELFHRGNSRS PLRQPIENFKSLDRSSDSQSPIRRHNGDSDA Protein Names:Recommended name: Nuclear rim protein 1 Gene Names:Name:NUR1 Ordered Locus Names:ZYRO0A07942g Expression Region:1-511 Sequence Info:fµLl length protein

1,874.00 € 1874.0 EUR 1,874.00 €

1,874.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product 

Check out what's in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.