ELISA Recombinant Schizosaccharomyces pombe Microsomal signal peptidase subunit 1(new19)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:G2TRR4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNYLEGTIDFAGQLRCQKYMNYGLCTSAVISYIYGYLVQDSYCVIKLFLILASLVALVCL PAWSMYNKNPLKFQKKKE Protein Names:Recommended name: Microsomal signal peptidase subunit 1 EC= 3.4.-.- Gene Names:Name:new19 ORF Names:SPBC887.22 Expression Region:1-78 Sequence Info:fµLl length protein