ELISA Recombinant Grapevine leafroll-associated virus 3 Protein P7 (ORF12)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Grapevine leafroll-associated virus 3 (isolate United States/NY1) (GLRaV-3) (Grapevine leafroll-associated closterovirus (isolate 109)) Uniprot NO.:O71197 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRHLEKPIRVAVHYCVVRSDVCDGWDVFIGVTLIGMFISYYLYALISICRKGEGLTTSNG Protein Names:Recommended name: Protein P7 Alternative name(s): 7 kDa protein Gene Names:ORF Names:ORF12 Expression Region:1-60 Sequence Info:fµLl length protein