ELISA Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 140L (IIV6-140L)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus) Uniprot NO.:O55746 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNINDYKDSIIVGVLFLLFTRDWFDELIFGTFPSLKGMPWVFLALKVLGIMVLFYLLDAI INVK Protein Names:Recommended name: Uncharacterized protein 140L Gene Names:ORF Names:IIV6-140L Expression Region:1-64 Sequence Info:fµLl length protein