Skip to Content

ELISA Recombinant Macaca fascicularis UDP-glucuronosyltransferase 2B18(UGT2B18)

https://www.colorectalresearch.com/web/image/product.template/142452/image_1920?unique=62ab6da
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Macaca fascicµLaris (Crab-eating macaque) (Cynomolgus monkey) Uniprot NO.:O97951 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SCGKVLVWAAEYSHWMNMKTILEELVQRGHEVTVLASSASILFDPNNSSALKIEVFPTSL TKTEFENIIRQQIKRWSELPKDTFWLYFSQMQEIMWKFGDITRNFCKDVVSNKKLMKKLQ KSRFDVVFADAIFPCSELLAELLNTPLVYSLRFTPGYNFEKHCGGFLFPPSYVPVVMSEL SDHMTFMERVKNMIYmLYFDFCFQIYAMKKWDQFYSEVLGRPTTLSETMGKADIWLIRNS WNFQFPHPLLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVTNMKEERA NVIASALAQIPQKVLWRFDGKKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGSNGIY EAIYHGVPMVGIPLFADQPDNIAHMKAKGAAVRLDFDTMSSTDLVNALKTVINDPLYKEN VMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAHDLTWFQYHSLDVIGFLLACV ATVIFIIMKCCLFCFWKFARKGKKGKSD Protein Names:Recommended name: UDP-glucuronosyltransferase 2B18 Short name= UDPGT 2B18 EC= 2.4.1.17 Gene Names:Name:µgT2B18 Expression Region:22-529 Sequence Info:fµLl length protein

1,871.00 € 1871.0 EUR 1,871.00 €

1,871.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product 

Check out what's in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.