Skip to Content

ELISA Recombinant Putative UDP-glucuronosyltransferase ugt-46(ugt-46)

https://www.colorectalresearch.com/web/image/product.template/114209/image_1920?unique=5e1ca23
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Caenorhabditis elegans Uniprot NO.:Q10941 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:YKILVFSPATSKSHLISNGRLADELARAGHDVTVLELDFLGISQTTNSVKVAKKRIIDGF QESTNFKNVLHGFSETVMEEPSFTDEIKGWWAYQNVYNDLCAEFLKMDDIFNELKNAKFD GFFAEQINLCGFGYAHALEIPRHFLISSCPFAAPVYDFTGLPMPTSTVAFAADLSISPTY TERARNLFVAVLTKLEFTLLNNRLQAHFQHKFGEHFPSLYSVTSDVDVIFVATDEIIDIS TTTLQNIVHVGGLGVDDDVAEMDNVFASEMSKGKEGVIYFSLGTIANTTKIDSKVMRTVL DIVKKFPDYHFVIRADKYDLSTREYAKSVSNAFVSDWLPQPAILHHPRLKLFITHSGYNS IVEAARAGVPLINIPFMFDQNLNSRAVEKKGWGIRRHKKQLLTEPEEIEKAISEIIHNKK YSLKAQRIRDLIKSKPLSSSQLLIKTTEWAIKNHGLDEIKFESRGQTTWTYYNLDVIIPV FWLSISLVIPTIFGWYKFSCFGHVEEKKGKSKRD Protein Names:Recommended name: Putative UDP-glucuronosyltransferase µgt-46 Short name= UDPGT 46 EC= 2.4.1.17 Gene Names:Name:µgt-46 Synonyms:µgt14 ORF Names:B0310.5 Expression Region:18-531 Sequence Info:fµLl length protein

1,878.00 € 1878.0 EUR 1,878.00 €

1,878.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product 

Check out what's in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.