ELISA Recombinant Shigella flexneri serotype 5b UPF0060 membrane protein YnfA(ynfA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Shigella flexneri serotype 5b (strain 8401) Uniprot NO.:Q0T4M5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALMWLRVVDGVKLSLYDWTGALIALCGmLIIVAGWGRT Protein Names:Recommended name: UPF0060 membrane protein YnfA Gene Names:Name:ynfA Ordered Locus Names:SFV_1562 Expression Region:1-108 Sequence Info:fµLl length protein