ELISA Recombinant Neurospora crassa ATP synthase subunit 9, mitochondrial(atp-9)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) Uniprot NO.:Q12635 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIQVAKIIGTGLATTGLIGAGIGIGVVFGSLIIGVSRNPSLKSQLFAYAILGFAFSEATG LFALMMAFLLLYVA Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein Gene Names:Name:atp-9 ORF Names:NCU16027 Expression Region:1-74 Sequence Info:fµLl length protein