ELISA Recombinant His1 virus Putative transmembrane protein ORF21(ORF21)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:His1 virus (isolate Australia/Victoria) (His1V) (HaloarcµLa hispanica virus 1) Uniprot NO.:Q25BH4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVEIDDGVEMAVGIFVVIILAANLLPTAFDQIFNASTSSWNSDVTTLWELLPLLSVVGLL LMFVYWARKAGKM Protein Names:Recommended name: Putative transmembrane protein ORF21 Gene Names:ORF Names:ORF21 Expression Region:1-73 Sequence Info:fµLl length protein