ELISA Recombinant Xenopus laevis Immediate early response 3-interacting protein 1(ier3ip1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q3B8G7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAFTLYTLLQAALLCVNAVAVLHEERFLSKIGWGVDHGIGGFGEEPGMKSQLMNLIRSVR TVMRVPLIIVNSVTIVLLLLFG Protein Names:Recommended name: Immediate early response 3-interacting protein 1 Gene Names:Name:ier3ip1 Expression Region:1-82 Sequence Info:fµLl length protein