ELISA Recombinant Staphylococcus haemolyticus Probable protein-export membrane protein SecG(secG)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus haemolyticus (strain JCSC1435)
Uniprot NO.:Q4L4K9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHTLFIVLLIIDCIALITVVLLQEGKSNGLSGAISGGAEQLFGKQKQRGVDLFLHRLTII LAVIFFLIMIGISYFGL
Protein Names:Recommended name: Probable protein-export membrane protein SecG
Gene Names:Name:secG Ordered Locus Names:SH2107
Expression Region:1-77
Sequence Info:fµLl length protein
Our Product
Check out what's in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.