ELISA Recombinant Pongo abelii Protein TRIQK(TRIQK)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5RDR6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGRKDAATIKLPVDQYRKQIGKQDYKKTKPILRATKLKAEAKKTAIGIKEVGLVLAAILA LLLAFYAFFYLRLTTDDDPDLDQDED Protein Names:Recommended name: Protein TRIQK Alternative name(s): Triple repetitive-sequence of QXXK/R protein homolog Gene Names:Name:TRIQK Expression Region:1-86 Sequence Info:fµLl length protein