ELISA Recombinant Gracilaria tenuistipitata var. liui ATP synthase subunit b', chloroplastic(atpG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Gracilaria tenuistipitata var. liui (Red alga) Uniprot NO.:Q6B8R1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIVFPFLLFQmLSTEVEGGLFDFNATLPLMALQFIILTTILNFIFYKPVTNVLDERDEYI RNSLTTASASLVKADELTKTYEQQLAESRKKAQDIIKVAQEQAQQIVSVKIKDAQAYGEK LVSEAFHQLSIQKEDALKTLEMQVDTLSDLIKSKLLND Protein Names:Recommended name: ATP synthase subunit b', chloroplastic Alternative name(s): ATP synthase F(0) sector subunit b' ATPase subunit II Gene Names:Name:atpG Ordered Locus Names:Grc000143 Expression Region:1-158 Sequence Info:fµLl length protein