ELISA Recombinant Gracilaria tenuistipitata var. liui Photosystem I reaction center subunit PsaK(psaK)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gracilaria tenuistipitata var. liui (Red alga)
Uniprot NO.:Q6B8M4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNLQTLLSMISNTSSWSISTAIIMVICNLLCIGLGRYAIQVRGLGPSIPALGLKGFGLPE LLATTSLGHIIGAGAIIGLNSIKIIN
Protein Names:Recommended name: Photosystem I reaction center subunit PsaK Alternative name(s): PSI-K Photosystem I subunit X
Gene Names:Name:psaK Ordered Locus Names:Grc000180
Expression Region:1-86
Sequence Info:fµLl length protein
Our Product
Check out what's in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.