ELISA Recombinant Methanococcus maripaludis UPF0333 protein MMP1283(MMP1283)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Methanococcus maripaludis (strain S2 / LL) Uniprot NO.:Q6LXR6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVALKKFFSKRGQLSLEFSVLVLAVITAAILLGYHLIVSSKAVQESNIDTINNTHNTAI DALSEVS Protein Names:Recommended name: UPF0333 protein MMP1283 Gene Names:Ordered Locus Names:MMP1283 Expression Region:1-67 Sequence Info:fµLl length protein