ELISA Recombinant Nycticebus coucang Cytochrome c oxidase subunit 6C(COX6C)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Nycticebus coucang (Slow loris) Uniprot NO.:Q7YRJ8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ASSALAKPQMRGLLARRLRIHIVGAFVVSLGVAAFYKYAVAEPRKKAYADFYRNYDSVKY FEEMRKAGVFQSVK Protein Names:Recommended name: Cytochrome c oxidase subunit 6C Alternative name(s): Cytochrome c oxidase polypeptide VIc Gene Names:Name:COX6C Expression Region:2-75 Sequence Info:fµLl length protein