Skip to Content

ELISA Recombinant Arabidopsis thaliana Isoprenylcysteine alpha-carbonyl methylesterase ICME(ICME)

https://www.colorectalresearch.com/web/image/product.template/116728/image_1920?unique=7f7b80c
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:Q94AS5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHSPLQTQQPEQRCWPMTSTVSEIEEVLPDEDSDRTTLLNGEPLRRRVSGKSPVDEGPRR IFRQQSFGRDIGHAAAETYLITGLSFKLLRYLGVGYRWMTKLLALTCYAmLLMPGFLQVA YSYFFSKQVRRSIVYGDQPRNRLDLYLPSNNDGLKPVVVFVTGGAWIIGYKAWGSLLGMQ LAERDIIVACLDYRNFPQGTISDMVTDASQGISFVCNNISAFGGDPNRIYLMGQSAGAHI AACALLEQATKELKGESISWTVSQIKAYFGLSGGYNLYKLVDHFHNRGLYRSIFLSIMEG EESFEKFSPEVRLKDPVVGKAASLLPPIILFHGSSDYSIPCDESKTFTDALQAVGAKAEL VLYSGKTHTDLFLQDPLRGGKDELFDDIVSVIHAEDNDGLTKDSLAPPRKRLVPELLLKL AREISPF Protein Names:Recommended name: Isoprenylcysteine alpha-carbonyl methylesterase ICME EC= 3.1.1.n2 Alternative name(s): Isoprenylcysteine methylesterase Prenylcysteine methylesterase Short name= AtPCME Gene Names:Name:ICME Synonyms:PCME Ordered Locus Names:At5g15860 ORF Names:F14F8.240 Expression Region:1-427 Sequence Info:fµLl length protein

1,786.00 € 1786.0 EUR 1,786.00 €

1,786.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product 

Check out what's in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.