ELISA Recombinant Methanosarcina acetivorans Tetrahydromethanopterin S-methyltransferase subunit G(mtrG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) Uniprot NO.:Q8TU05 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDGKAPAAYVDPAEFNEVMKRLEKIDEKVEFVNSEVAQRIGKKVGRDIGILYGAVVGLLL FLIYVSVSSMFTI Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit G EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit G Gene Names:Name:mtrG Ordered Locus Names:MA_0270 Expression Region:1-73 Sequence Info:fµLl length protein