ELISA Recombinant Helianthus annuus Cytochrome c oxidase subunit 5C-1(COX5C1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Helianthus annuus (Common sunflower) Uniprot NO.:Q8VY40 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVGGRVAHPVLKGPSEVKELIIGSVLGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVV VQE Protein Names:Recommended name: Cytochrome c oxidase subunit 5C-1 Alternative name(s): Cytochrome c oxidase polypeptide Vc-1 Gene Names:Name:COX5C1 Expression Region:1-63 Sequence Info:fµLl length protein