Skip to Content

ELISA Recombinant Mycoplasma pneumoniae Probable protein-export membrane protein SecG(secG)

https://www.colorectalresearch.com/web/image/product.template/147187/image_1920?unique=90f0e4f
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129) Uniprot NO.:Q9EXD0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDAIQIVMFVMAILCLIIGLLLSNHGSTGGLASLSGQDLEIFRKTKDRGIVKILQITMFI LVVLFLILGLVFHFAL Protein Names:Recommended name: Probable protein-export membrane protein SecG Gene Names:Name:secG Ordered Locus Names:MPN_242 ORF Names:MP589.1 Expression Region:1-76 Sequence Info:fµLl length protein

1,415.00 € 1415.0 EUR 1,415.00 €

1,415.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Product 

Check out what's in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.