ELISA Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 2(PCR2)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q9LQU4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEAQHLHAKPHAEGEWSTGFCDCFSDCKNCCITFWCPCITFGQVAEIVDRGSTSCGTAGA LYALIAVVTGCACIYSCFYRGKMRAQYNIKGDDCTDCLKHFCCELCSLTQQYRELKHRGY DMSLGWAGNVERQQNQGGVAMGAPVFQGGMTR
Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 2 Short name= AtPCR2
Gene Names:Name:PCR2 Ordered Locus Names:At1g14870 ORF Names:F10B6.27
Expression Region:1-152
Sequence Info:fµLl length protein
Our Product
Check out what's in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.