ELISA Recombinant Oryza sativa subsp. japonica Hydrophobic protein OSR8(OSR8)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Oryza sativa subsp. japonica (Rice) Uniprot NO.:Q9LRI7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASGRCCTFLEILLAIILPPLGVFLRFGCCSMEFCICLLLTILGYVPGIIYAVYVLVALD SDQYQREYHTLA Protein Names:Recommended name: Hydrophobic protein OSR8 Gene Names:Name:OSR8 Ordered Locus Names:Os09g0558100, LOC_Os09g38560 ORF Names:OJ1065_E04.3 Expression Region:1-72 Sequence Info:fµLl length protein