ELISA Recombinant Uncharacterized protein pXO2-13-BXB0012-GBAA_pXO2_0012(pXO2-13, BXB0012, GBAA_pXO2_0012)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus anthracis
Uniprot NO.:Q9RN19
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKVIDIANRRRIYFEMKQQELRASILMTVAGFIIAFAILVFQISFELGHLYHYIVTFAFL TYLSLHLYSNNKLARKIEKKQQGY
Protein Names:Recommended name: Uncharacterized protein pXO2-13/BXB0012/GBAA_pXO2_0012
Gene Names:Ordered Locus Names:pXO2-13, BXB0012, GBAA_pXO2_0012
Expression Region:1-84
Sequence Info:fµLl length protein
Our Product
Check out what's in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.