ELISA Recombinant Uncharacterized protein pXO2-13-BXB0012-GBAA_pXO2_0012(pXO2-13, BXB0012, GBAA_pXO2_0012)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus anthracis Uniprot NO.:Q9RN19 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKVIDIANRRRIYFEMKQQELRASILMTVAGFIIAFAILVFQISFELGHLYHYIVTFAFL TYLSLHLYSNNKLARKIEKKQQGY Protein Names:Recommended name: Uncharacterized protein pXO2-13/BXB0012/GBAA_pXO2_0012 Gene Names:Ordered Locus Names:pXO2-13, BXB0012, GBAA_pXO2_0012 Expression Region:1-84 Sequence Info:fµLl length protein