ELISA Recombinant Herpes simplex virus type 2 ICP47 protein(US12)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Others Uniprot ID:P60504 Gene Names:US12 Organism:Herpes simplex virus type 2 (strain SA8) (Simian agent 8) AA Sequence:MSSLYLATVDAFLRNPHTRHRTCADLRRELDAYADEERREAAKAIAHPDRPLLAPPSAPPNHSHLAARETAPPPAATP Expression Region:1-78aa Sequence Info:FµLl Length Source:E.coli Tag Info:N-terminal 6xHis-KSI-tagged MW:23.9 kDa Alternative Name(s):Immediate-early protein IE12 (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12) Relevance:Plays a role in the inhibition of host immune response. Binds specifically to transporters associated with antigen processing, thereby blocking peptide-binding and translocation by TAP as well as subsequent loading of peptides onto MHC class I molecµLes. Empty MHC I molecµLes are retained in the endoplasmic reticµLum and µLtimately directed to proteasomal degradation. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes. Reference:"Identification of an ICP47 homolog in Simian agent 8 (SA8)." Bigger J.E., Martin D.W. Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Plays a role in the inhibition of host immune response. Binds specifically to transporters associated with antigen processing (TAP), thereby blocking peptide-binding and translocation by TAP as well as subsequent loading of peptides onto MHC class I molecµLes. Empty MHC I molecµLes are retained in the endoplasmic reticµLum and µLtimately directed to proteasomal degradation. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes. Involvement in disease: SubcellµLar Location:Host cytoplasm, Host nucleus Protein Families:Herpesviridae US12 family Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:13-23 business days