ELISA Recombinant Mouse C-X-C motif chemokine 10(Cxcl10)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P17515 Gene Names: Cxcl10 Organism: Mus muscµLus (Mouse) AA Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP Expression Region: 22-98aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 35.7 kDa Alternative Name(s): 10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10 Relevance: In addition to its role as a proinflammatory cytokine, may participate in T-cell effector function and perhaps T-cell development. Reference: "Structure of mouse IP-10, a chemokine."Jabeen T., Leonard P., Jamaluddin H., Acharya K.R.Acta Crystallogr. D 64:611-619(2008) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.