ELISA Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Ab(cry1Ab),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P0A370
Gene Names: cry1Ab
Organism: Bacillus thuringiensis subsp. kurstaki
AA Sequence: HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Expression Region: 1022-1155aa
Sequence Info: Partial
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 17.3 kDa
Alternative Name(s): 130KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b)
Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
Reference: Characterization of Bacillus thuringiensis subsp. kurstaki strain S93 effective against the Fall armyworm, Spodoptera frµgiperda and cloning of a cry1Ab gene.Silva-Werneck J.O., De-Souza M.T., Dias J.M.C.S., Ribeiro B.M.Can. J. Microbiol. 45:464-471(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Product
Check out what's in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.